SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037787 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037787
Domain Number 1 Region: 206-306
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-28
Family Ras-binding domain, RBD 0.0000024
Further Details:      
 
Domain Number 2 Region: 341-446
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.06e-23
Family FHA domain 0.00000131
Further Details:      
 
Domain Number 3 Region: 1-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.41e-22
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 4 Region: 950-1047
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-22
Family PDZ domain 0.0000272
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000037787
Domain Number - Region: 1318-1399
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0706
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037787   Gene: ENSCAFG00000000860   Transcript: ENSCAFT00000047722
Sequence length 1774
Comment pep:known chromosome:CanFam3.1:1:55435472:55536326:1 gene:ENSCAFG00000000860 transcript:ENSCAFT00000047722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEE
RRLDIDEKPLVVQLNWNKDDREGRFVLKNENDALAPKKAQSNGPEKQEKEGVIQNFKRTL
SKKEKKEKKKREKEAVRQASDKDDRPFQGDDIENSRLAAEVYKDMPETSFTRTISNPEVV
MKRRRQQKLERRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEA
LEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEMILDDDECPLQIFREWPSDKGLLVF
QLKRRPADYIPKKTKKHVDGKLVKGKERAEGSAYGSALPPEKLPYLVELSPDGSDSRDKP
KLYRLQLSVTEVGTEKFDENSIQLFGSGIQPHHCDLTNMDGVVTVTPRSMDAETYVEGQR
ISETTMLQSGMKVQFGASHVFKFVDPSQDHALAKRSVDGSLTAKGPRHKPGIVQETTFDL
GGDVHSGTALPTSKSTTRLDGDRVLSASSTAERGMVKPMMRVEQQQDYRRQENRTQDAPG
PELILPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSSQYRPDVSP
TERTHKVIAIVNKMVSMMEGVIQEVDQVDQKQKNIAGALAFWMANASELLNFIKQDRDLS
RITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDDVLHTLTGA
MSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPESGLCSHYWGAIIRQQLGHVEAW
AEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQALLQNYHCAP
DEPFIPTDLIENVVAVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNIP
NGLQEFLDPLCQRGFCRLIPHARSPGTWTIYFEGADYESHLLRENTELAQPLRKEPEIIT
VTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGL
SQERAAELMTRTSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRISDRRGSGKPRPKSEGF
ELYNNSAQNGSPESPQLPWAEYTEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGGKSAY
APGTTAKITSVSTGNLCTEEQTPPPRPEAYPIPTQTYTREYFTFPASKSQDRMAPPQNQW
PNYEEKPHMHMDNNHSSIAIQRVTRSQEELREDKAYQLERHRIEAVLDRKSDSDMWIHQS
SSVGSSTSSQEHLDHPSKAGTPASTLTKSGPGRWKTPAAVQPLPVAGSQPVQTDLPPPPP
PPPTHYAGDFDGIPTDLPLPPPPASQTGPASAQVVAAERKKREEHQRWYEKEKARLEEER
DRKRREQERKLGQMRSQSLNPAPFSPVTVPHVKPEKPSTLQRPQETVIRELQPQQQPRTI
ERRDLQYITVSKEELSSGDSLSPDPWKRDAREKLEKQQQMHIVDMLSREIQELQNKPERS
AEENDRLRKLMLEWQFQKRLQESKQKDEDDEEEEDDDVDTMLIMQRLEAERRARLQDEER
RRQQQLEEMRKREAEDRARQEDERRRQEEERAKRDAEEKRRQEEGYYSRLEAERRRQHAE
AERRLLEPEEPGLCRPPLPRGYKLPSPSPPAAAPPPPPQRTASSLQAQALSPDSLYTARL
VAYHEEEEEEHCSLAGPNSYLGSAGTAVGTHDAYRDPRERLSKSHEADLPGSSGAPENLT
FKERQRLFSQGQDVSNKVKASRKLTELENELNTK
Download sequence
Identical sequences J9NWX6
ENSCAFP00000037787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]