SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037847 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037847
Domain Number 1 Region: 7-71
Classification Level Classification E-value
Superfamily PH domain-like 0.000000902
Family Third domain of FERM 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037847   Gene: ENSCAFG00000032080   Transcript: ENSCAFT00000043372
Sequence length 232
Comment pep:novel chromosome:CanFam3.1:1:55595795:55599997:-1 gene:ENSCAFG00000032080 transcript:ENSCAFT00000043372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLDGLPSARKLVYYTGCAWRSRHLLQLLSASHQLHLSLRPALQRLRQREEAEEKEHYRE
SYIRDTLDLDLDLDPDPGGRGSLGSGGSSQHVPRRLSLGSADSCSSSHTSGVREAGEMAV
DEPPGAEALHVEMPPCGSSSIRSGHGSEAGSRGRPEGDGRARGDASGPEPSAVVQVPLIR
MRGRCAEALYQMPEAEPPHHSLDRAPPGTCRSTNSLYLVLCREDQLLEEFVV
Download sequence
Identical sequences J9NX35
ENSCAFP00000037847 ENSCAFP00000037847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]