SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037855 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037855
Domain Number 1 Region: 404-626
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-56
Family DBL homology domain (DH-domain) 0.00019
Further Details:      
 
Domain Number 2 Region: 192-323
Classification Level Classification E-value
Superfamily BRCT domain 3.2e-22
Family DNA topoisomerase II binding protein 1, TopBP1 0.058
Further Details:      
 
Domain Number 3 Region: 106-221
Classification Level Classification E-value
Superfamily BRCT domain 1.01e-18
Family DNA ligase 0.031
Further Details:      
 
Domain Number 4 Region: 617-762
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000815
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037855   Gene: ENSCAFG00000015455   Transcript: ENSCAFT00000049237
Sequence length 942
Comment pep:known_by_projection chromosome:CanFam3.1:34:36896960:36960471:1 gene:ENSCAFG00000015455 transcript:ENSCAFT00000049237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNSLLTSTTGRTSLADSSIFDCKVTEISKENVFIGSASYVEEEMPQIETRMILVQDAG
KQEELIKALKEIKVPFVKMESLEEFEGLDSPEFENVFIVTDFQDSVFNELHKMDHRIVGP
PVILNCAQKGEPLPFSCRPLYCTSMMNLVLCFTGFRKKEELVRLVTLVHHMGGVIRKDFN
SKVTHLVANCTQGEKFRIAVSLGTPIMKSEWIYKAWERRNEQDFSASVDDFKNEFKVPPF
QDCILSFLGFSDEEKTNMEEMTKMQGGNCLPVGDERCTHLVVEENIVKELPFEPSKKLYV
VKQEWFWGSIQMDARAGETMYLYEKANTPELKKSVSLLSLNTPNSNRKRRRLKETLAQLS
RETDMSPFPPRKRPSAEHSLSIGSLLDISNTPESSINYGETPKSCTKSSKNSTPVPSKQS
ARWQVAKELYQTESNYVNILATIIQLFQVPLEEEGQRGGPILAPEEIKTIFGSIPDIFDV
HMKIKDDLEDLIVNWDESKSIGDIFLKYSKDLVKTYPPFVNFFEMSKETIIKCEKQKPRF
HAFLKINQAKPECGRQSLVELLIRPVQRLPSVALLLNDLRKHTAEENPDKSTLEKAIGSL
KEVMTHINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLVQRVETISLGEHPCDRGEQ
VTLFLFNDCLEIARKRHKVIGTFRSPPGHTRPPASLKHVHLMPLSQIKKVLDIRETEDCH
NAFALLVRPPTERANVLLSFQMTSEELPKENWLKMLCRHVANTICKADAENLIYSADPES
FEVNTKDMDSTLSRASRAIKKTSKKVTRAFSFSKTPKRALRRALMTSQSSVEGRSPSSND
KHVMSRLSSTSSLAIVHSVSTSNIIGFTKHVYVQRSNSTGGRSQNSWFRSIRHSASRASF
SEILKGTIDFSNFKKSPIQVIFDICEELGDMPTSNGNKPREV
Download sequence
Identical sequences J9NX43
ENSCAFP00000037855 ENSCAFP00000022777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]