SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037875 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037875
Domain Number 1 Region: 32-127
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-26
Family SH2 domain 0.00000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037875   Gene: ENSCAFG00000015778   Transcript: ENSCAFT00000047167
Sequence length 361
Comment pep:known_by_projection chromosome:CanFam3.1:20:46319343:46329695:-1 gene:ENSCAFG00000015778 transcript:ENSCAFT00000047167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEARKLPPPLPPRLDWFVQTQVGQLAQGGVPAWFHGAISREDAENLLELQPLGSFLIRV
SHSHVGYTLSYKAQSCCRHFMVKLLDDGSFRIPGQEKTHASLDALVTFHQQQPVRPHGDL
LTQPCGQEDPVNVDYEDLFLYSNALTEEVTSPAHGPRELQSPSSYPRAAAPEETSTRPAL
LHWPKGRKPAAEMDRASTQEATSPSPPKAPLAETRRKLWKNLKMLPQMGKRVQQQLTSHQ
TSMNSSSLWSSGPPVVTHSSGARPGDTNCEDNVNTDCFVATPIASPSEPQDLRNRGDPSR
RASRLASWSEATPSTRSWHQVVVRALSSKVSKSETKDLIEPQKDWLPEEYRPPPPFAPGY
C
Download sequence
Identical sequences J9NX63
ENSCAFP00000037875 ENSCAFP00000037875 XP_005632809.1.84170 XP_005632810.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]