SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037886 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037886
Domain Number 1 Region: 52-234
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.71e-47
Family Ankyrin repeat 0.00029
Further Details:      
 
Domain Number 2 Region: 275-336
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000122
Family SAM (sterile alpha motif) domain 0.022
Further Details:      
 
Domain Number 3 Region: 243-300,385-421
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000183
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037886   Gene: ENSCAFG00000003419   Transcript: ENSCAFT00000047999
Sequence length 475
Comment pep:known_by_projection chromosome:CanFam3.1:14:56197737:56250110:-1 gene:ENSCAFG00000003419 transcript:ENSCAFT00000047999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGALRSQAVAGGGESSESEDDGWEIGYLDRAVQKLKGPLLPEEKNETFKKALTSGDTS
LVKELLDSGISVDSSFRYGWTPLMYAASVSNVELVRVLLDKGANASFDKDKQTILITACS
ACGSEEQILKCVELLLSRNADPNVPCRRLMTPIMYAARDGHPQVVALLVAHGAEVNTQDE
NGYTALTWAARQGHKNVVLKLLELGANKMLQTKDGKTPSEIAKRNKHLEIFSFLSLTLNP
LEGKLQHLTKEETICKLLTMDSDKEKDHIFSSYTAFGDLEIFLHGLGLEHMMDLLKERDI
TLRHLLTMQKDEFTKNGITSRDQQKILAALKELEVEEIKFGELPEVAKLEISGDEFLNFL
LKLNKQCGHLITAVQNIITELPVNSHKIVLEWASPRNFTSVCEELVSNVEDLSEEVCKLK
DLIQKLQNERENDPTHIPLMEEVSTWNSRILKRTAITICGFGFLLFVCKLTFQRK
Download sequence
Identical sequences J9NX74
XP_852716.2.84170 ENSCAFP00000037886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]