SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037902 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037902
Domain Number 1 Region: 481-601
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-34
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 
Domain Number 2 Region: 208-294
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-16
Family PDZ domain 0.019
Further Details:      
 
Domain Number 3 Region: 23-76
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000061
Family SAM (sterile alpha motif) domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037902   Gene: ENSCAFG00000000562   Transcript: ENSCAFT00000046865
Sequence length 900
Comment pep:known_by_projection chromosome:CanFam3.1:1:44071408:44316651:-1 gene:ENSCAFG00000000562 transcript:ENSCAFT00000046865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVPLLISSPLVEREWKVGLDDCLQQYVHKFEREKINGEQLLKISHQDLEELGVTRIGHQE
LVLEAVDLLCALNYGLETDNMKNLVLKLRASSHNLQNYISSRRKSPAYDGNTSHKPPNEF
LTSVVELIGAAKALLAWLDRAPFTGITDFSVTKNKIIQLCLDLTTTVQKDCLVAEMEDKV
LAVVKVLNGICDKTIRSTTDPVMSQCACLEEVHLPNVKPGEGLGMYIKSTYDGLHVITGT
TENSPADRSQKIHAGDEVIQVNQQTVVGWQLKNLVRKLRENPTGVVLLLKKRPTGSFNFT
PAPLKNLRWRPPLVQTSPPPTTTQSPESTMDTSLKKEKPAILHLYIPPPPAVPYSPRDEN
ESFLYGGFSKCKQPVPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILATKMR
EKTPSYGKPRPLSMPADGSWMGIVDPFARPRGHGRKAFVSTNLTSYMATDGNALVPLRQK
QRKKTQGFFTMSRRRISCKDLGHADCQGWLYKKKEKGTFLSNKWKKFWVVLKGTSLYWYS
NQMAEKADGFVNLPDFSVERASECKKKHAFKISHPQIKTFFFAAENAQEMSVWLNKLGLA
VIHHESATKDEECYSESEQEDPEIAVETPPPPYSAETFSPLVLFMKQAAQQAPSSSPKSC
SCSSLESTIKTQSSLASFSRDRQSWIDMGNSSAAADNEEQSIMFAVAVRSSAPAEANSCR
ALENSFATSESGFLNSLSSDDTSSLSSNLDHLAVPDQPTGSKMADRVEETKLSEDDEMEK
LYKSLEQASLSPLGDRRPSTKKELRKSFVKRCKNPSINEKLHKIRTLNSTLKCKEHDLAM
INQLLDDPKLTARKYREWKVMNTLLIQDIYQQQRAPMSAHEGTPEGLEKPPSSACVENSI
Download sequence
Identical sequences J9NX90
ENSCAFP00000000788 ENSCAFP00000037902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]