SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037941 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037941
Domain Number 1 Region: 146-239
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-29
Family Pleckstrin-homology domain (PH domain) 0.0000049
Further Details:      
 
Domain Number 2 Region: 13-127
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-26
Family SH2 domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037941   Gene: ENSCAFG00000010571   Transcript: ENSCAFT00000044969
Sequence length 249
Comment pep:known_by_projection chromosome:CanFam3.1:32:21784763:21811886:1 gene:ENSCAFG00000010571 transcript:ENSCAFT00000044969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQWFSNTQNAVQHVQKRMWYHGNLTRHAAEALLLSNGCDGSYLLRDSNERTGLYSLSVRA
KDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLIVLKHPYPRKVEEP
SIYESVRVHTAMQTGRTENDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYF
KDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRW
KLSQIRKQL
Download sequence
Identical sequences J9NXC9
ENSCAFP00000037941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]