SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037969 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037969
Domain Number 1 Region: 355-578
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-50
Family DBL homology domain (DH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 582-715
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 3 Region: 109-197
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000258
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037969   Gene: ENSCAFG00000019602   Transcript: ENSCAFT00000049615
Sequence length 1043
Comment pep:known_by_projection chromosome:CanFam3.1:5:60320850:60347393:-1 gene:ENSCAFG00000019602 transcript:ENSCAFT00000049615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRGRAAKVCHHADCQQLHRRGPLNLCEACDSKFHSAMHYDGHVRFDLPPQGSILARNVS
TRSCPPRTSPAVDLEEEEESSMDGKGDRKSTGLKLSKKARRRHTDDPSKECFTLKFDLNV
DIETEIVPAMKKKSLGEVLLPVFERKGIALGKVDIYLDQSNTPLSLTFEAYRFGGHYLRV
KAKPGDEGKVEQGVKDSKSLSLPILRPARAGTPSLERVDPQSRRESLDILAPGRRRKNMS
EFLGETSIPGQEASTPSSCSLPSGSSGGSDSWKNRAASRFSGFFSSGPSTSTFGREVDKM
EQLEAKLHTYGLFGLPRLPRRLRFDHDSWEEEGDEEEEEDDACLWLEDSWRELIDGHEKL
TRRQCHQQEAVWELLHTEVSYIKKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNIPEL
ARLHRGLWAGTMAPVLEKARRTRALLQPGDFLRGFKMFGSLFRPYIRYCMEEEGCMEYMR
GLLRDNELFRAYVTWAEKHQQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTDEPRAKEA
VVTMIDSVERFIHHVNACMRQRQERQRLAAVVSRIDAYEVVEGSNDEVDKLLKEFLHLDL
TAPIPGASPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLLVTKAVKKAERTKVIRPP
LLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYTFQASGQALCRGWVEAIYNAQNQLQQLR
VQEHPGSQQPLQSLEEEDDEQEEEDEEDEDEEEEEGGGSSTSAASSPTILRKSSNSLNSQ
HCASDGSTETLAMVVVEPGETLSSPEFEGGPFGSQSDETSLSTTASSVTPISELLPLGPV
DGRSCSMDSAYGTLSPTSLQDFMAPAPVAEPLPRPPELPQAPSPLSSPRLRRRSPVQLLP
RLPHLLKSKSEASLLQLLSGATTSGAPPAPSRSLSELCLAVAGRGTRTQGSSREPGPSWV
RQGTPSPSSGPEPSELEGRTSCLAGEPERPTRRSRDLPLGASPRVQPEPPPGISAQHRKL
TLAQLYRIRTTLLLNSTLTASEV
Download sequence
Identical sequences J9NXF6
XP_005620518.1.84170 ENSCAFP00000037969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]