SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037982 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037982
Domain Number 1 Region: 295-494,660-879,917-948
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.64e-129
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000308
Further Details:      
 
Domain Number 2 Region: 509-661
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 4.32e-55
Family ValRS/IleRS/LeuRS editing domain 0.0000436
Further Details:      
 
Domain Number 3 Region: 950-1208
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.06e-50
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00012
Further Details:      
 
Domain Number 4 Region: 87-209
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.23e-21
Family Glutathione S-transferase (GST), C-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000037982
Domain Number - Region: 1196-1258
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0487
Family Valyl-tRNA synthetase (ValRS) C-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037982   Gene: ENSCAFG00000000636   Transcript: ENSCAFT00000049788
Sequence length 1264
Comment pep:known_by_projection chromosome:CanFam3.1:12:1253967:1269370:-1 gene:ENSCAFG00000000636 transcript:ENSCAFT00000049788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLYVSPHPDAFPSLRALIAARYGEAGEGPGWGGAHPRICLQPPPTSRTPCPPPRLPAL
ERGPGGLWVWGATAVAQLLWPAGLGGPGGSRAAVLVQQWVSYADTELIPAACGATLPALG
LRSAAQDPQAALGALGRALSPLEEWLRLHTYLAGEAPTLADLAAVTALLLPFRYVLDPSA
RRIWGNVTRWFTTCVQQPEFRAVLGEVVLYSGARLLSQQPGPEVPAPPKTASQLKKEAKK
REKLEKFQQKQKTQQQQPPPAEKKPKPEKRGKRDPGVITYDLPTPAGEKKDVSGTMPDSY
SPQYVEAAWYPWWEQQGFFQPEYGRSSVSAANPRGVFMMCIPPPNVTGSLHLGHALTNAI
QDSLTRWHRMRGETTLWNPGCDHAGIATQVVVEKKLWREQGLSRHQLGREAFLREVWKWK
EEKGDRIYHQLKKLGSSLDWNRACFTMDPKLSAAVTEAFVRLHEEGVIYRSTRLVNWSCT
LNSAISDIEVDKKELTGRTLLSVPGYKEKVEFGVLVSFAYKIQGSDGDEEVVVATTRIET
MLGDVAVAVHPKDPRYQHLKGRSVIHPFLSRSLPIIFDDFVDMEFGTGAVKITPAHDQND
YEVGRRHRLEAITIMDSQGALINVPPPFLGLPRFEARKAVLAALKEQGLFRGVEDNPMVV
PLCNRSKDVVEPLLRPQWYVRCGEMAQAASAAVTRGDLRILPEAHQRTWHTWMDNIRDWC
ISRQLWWGHRIPAYFVTVSDPAVPPGEDPDERYWVSGRSKAEAREKAAKEFGVSSDKISL
QQDEDVLDTWFSSGLFPFSIFGWPNQSEDLSVFYPGTLLETGHDILFFWVARMVMLGLKL
TGKLPFREVYLHAIVRDAHGRKMSKSLGNVIDPLDVIHGVSLQGLHDQLLNSNLDPSEVE
KAKDGQKADFPAGIPECGTDALRFGLCAYTSQGRDINLDVNRILGYRHFCNKLWNATKFA
LRGLGKGFVPSATSEPGGHESLVDRWIRSRLTEAVRLSNQGFQAYDFPAVTTAQYSFWLY
ELCDVYLECLKPVLNGMDHVVAECARQTLYTCLDVGLRLLSPFMPFVTEELFQRLPRRTL
QAPPSLCVTPYPEPSECSWKDPEAEAAMELALSITRAVRSLRADYNLTRIRPDCFLEVAD
EATGILASAVSAYVQALASAGVVAVLALGAPAPQGCAVALASDRCSVHLQLQGLVDPARE
LGKLQAKRSEAQRQAQRLRERRAASGYPVKVPLEVQEADRAKLQQIEAELKKVDEAIALF
QKML
Download sequence
Identical sequences E2RTJ7
ENSCAFP00000000899 ENSCAFP00000037982 XP_538837.3.84170 ENSCAFP00000000899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]