SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038098 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038098
Domain Number 1 Region: 96-304
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-54
Family DBL homology domain (DH-domain) 0.0000385
Further Details:      
 
Domain Number 2 Region: 289-417
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-26
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038098   Gene: ENSCAFG00000005521   Transcript: ENSCAFT00000046253
Sequence length 1387
Comment pep:known_by_projection chromosome:CanFam3.1:1:113802158:113810665:-1 gene:ENSCAFG00000005521 transcript:ENSCAFT00000046253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGARGPSLSKPSPGLGRGPTGEVCNCAAVCETQTAPATPAMASPRGSGSSTSLSTVGS
EGDPAPGPTPACSASRPEPLPGPPIRLHLSPVGTPGSAKPSRLERVAREIVETERAYVRD
LRSIVEDYLGPLLDGGVLGLSAEQVGILFANIEDIYEFSSELLEDLEGSPSAGGIAECFV
QRSEDFDIYTLYCMNYPSSLALLRELSLSPPAALWLQERQAQLHHSLPLQSFLLKPVQRI
LKYHLLLQELGKHWAEGPGAGGREMVEEAIVSMTAVAWYINDMKRKQEHAARLQEVQRRL
GGWTGPELSAFGELVLEGAFRGGGGGGPRLRGGERLLFLFSRMLLVAKRRGPEYTYKGHI
FCCNLSVSESPRDPLGFKVSDLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIPA
KAKQVLLENSLHCAPKSKPIPEPLTPPLGSPRPRDARSFTPGRRNTAPSPGPSATRRGRR
QSEPMKDPYVMFPQNAQPRLKHAGSEGELYPTLEPQPSVPASGPPEDLEDTGPPTLEPSG
TSITEEILELLNQRGLRDPAPSPHDIPKFPGDSQVPEGSDPLTFQALPSRDSSEEEEEEE
LEMDERGPSPLHVLEGLESSSTAENPDVPGLTKSPDTPNLPEIPSLAEIPKIPHLPSLSD
ISSVFEMPCLPAIPSVPDIPSLPSAPTLPCDSWLQGPLRGPDEALATRRELFPGSSSTKL
GEPSSGGRAGREEAAEGESFPDFQPQDVPRDQGIPDELEFRSCSEIRSAWQALEQGQLAR
PGFPEPLLILEDSDLGGGSGGSGKAGAPSSSSERAASRVRELARLYSERIQQMQRAETRA
SANAPRRRPRALAQPQLSPCLPHEQAEPGPLPAFGHVLVCELAFPLTCAQESVPLGPATR
VQAATPLSKQGGCLGGEGLNVSNLPEQDHLGIQVPAAAPLPERRGLWNIQSVAGAAAAVP
KQEDAPGVRVPATALPAQEAHLEIQVPGTAPLAEDGGHVDIRDPSSPALPRRGCCSDVTV
VATATTLKQEGHLRTQTLAGTPLTKQGGPRDVQFPAGGCDQAMNTLLTRGGNHQIPGSTP
LPLRHELPDIQAPGASPVPACGGHLSHHVPAGAPLSSPQDCSDVQAPNPSPLPAHGSCLD
DRVPASTPLCVPHNPEVPATTPLPQQPGLPDTQVQALPPLPEQDSLPDSAGPSAAPLLEQ
KSLTDGHGPAAMLSPERRGSQDIQGLVPTPGQSAVVMSKPGGHLVSPVVRSETSELTPPH
SPAPPTRQLLGPNAAALSRYLAASYISQSLARRQGPGGDAPAASRGPWSSSAPASRAPSP
PPQPQPPPPPARRLSYATTVNIHVGGGGRLRPAKAQVRLNHPTLLAPPQESVGLRGAQGT
PDAPFHT
Download sequence
Identical sequences J9NXT2
XP_005616652.1.84170 ENSCAFP00000038098 ENSCAFP00000008254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]