SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038135 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038135
Domain Number 1 Region: 105-216
Classification Level Classification E-value
Superfamily SH2 domain 2.77e-19
Family SH2 domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038135   Gene: ENSCAFG00000007784   Transcript: ENSCAFT00000047992
Sequence length 234
Comment pep:known_by_projection chromosome:CanFam3.1:17:39602780:39609001:-1 gene:ENSCAFG00000007784 transcript:ENSCAFT00000047992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKAAQSLWEARKQGQPFPFGKQELAAPARVVPGLPKKSDEDLYLECEPSPVLALTQAPS
SQVLMPPISLPRISAVPKPTVAPQEARNGAANGTSKGRRSSLSSRAPTWSTPAAEDGSLL
GQPWYSGTRDRHAVESALLRFRKDGAYTVRPSSEPQGSQPLTLAVLLHGRVFNIPIRRLD
GGSHYALGREGRNHEELFPSVAAMVQHYSQHPLPLVDRHSGSRQLTCLLFPTTP
Download sequence
Identical sequences J9NXW8
ENSCAFP00000038135 ENSCAFP00000011517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]