SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038280 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038280
Domain Number 1 Region: 362-597
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.54e-55
Family DBL homology domain (DH-domain) 0.0000374
Further Details:      
 
Domain Number 2 Region: 597-721
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-31
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 
Domain Number 3 Region: 161-234
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000778
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038280   Gene: ENSCAFG00000011376   Transcript: ENSCAFT00000047501
Sequence length 1202
Comment pep:known_by_projection chromosome:CanFam3.1:3:49244160:49311844:1 gene:ENSCAFG00000011376 transcript:ENSCAFT00000047501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSEPVLQFFKIFCTSQACHRSKQQGFNYCTSAISSPLTKSISLMTISHPGLDPQPRMQP
ARRVSFSVHISPHLLKSKTLFSLGSSYSSDDEEELHNSRPFHSTSANLTESITEETYSFL
PQSPSKKDFEGKSGTKVSRTFSYIKNKMSSSKKSREKEKEKEKIKEKEKDLKEKDKKTIN
GHTFSPIPVVGPISCSQCVKPFTSKDAYTCAGCSAFVHKGCRESLASCAKVKMKQPRGSL
QAQDTSSLPTVIMRSKPSQPKERPRSAVLLADEATAIPMFANRRSQQSISLSKSVSIQNI
AGVGNDENISNTWKFLSHSTDSLNKISKVNESTESLTDEGTDMNEGQLMGDFEMESKQLE
AESWSRVVDSKFLKQQKKDVVKRQEVIYELMQTELHHIRTLKIMSDVYSRGMMTELLFEQ
QTVEKLFPCLDELISIHSQFFQRILERKKESLVDKSEKNFLIKRMGDVLVNQFSGENAER
LKKTYGKFCGQHNQSVNYFKDLHTKDKRFQAFVKKKMSSAVVRRLGIPECILLVTQRITK
YPVLFQRILQCTKDNEVEQEDLAQSLSLVKDVIGAVDSKVASYEKKVRLNEIYTKTDSKS
IMRMKSGQMFAKEDLKRKKLVRDGGVFLKSAAGRLKEVQAVLLTDILVFLQEKDQKYVFA
SLDQKSTVISLKKLIVREVAHEEKGLFLISMGMKDPEMVEVHASSKEERNSWIQIIQDAI
NTLNRDEDEGIPSENEEEKRILDTKARELKEQLQQKDQQILLLLEEKEMIFRDMTECSTP
LPEDCSPTHSSRILFRSNTEEALKGGPLMKSAINEVEILQGLVSGSLGGTLGPAVSSPVE
QEGIVGPVSLPRRAETFGGFDSHQMNASKGGEKEEGEDGQDLRRTESDSGLKKGGNANLV
FMLKRNSEQLVQSVIHLHELLSTLQGVVLQQDSYIEDQKLLLAERALTRSSSRPSSLVEQ
EKQRSLEKQRQDLANLQKQQAQHLEEKRRREREWEARERALQEREARLAQREQDVWRGQQ
DLDREREELQHKKGAYQCDLERLRTAQKQLEREQEQLKRDAERLSQRQVEHDACQVSYQH
TKLLRIPSFFPNPEEPPMPSVPSIAKSGSLDSELSVSPKRNSISRTHKDKGPFHILSSTS
QTNKVPEGQSQTPVPASASTRLFGLAKPKEKKEKKKKNKGSRSQPCDGPGSEVPTEGEEI
FC
Download sequence
Identical sequences J9NYB2
ENSCAFP00000038280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]