SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038329 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038329
Domain Number 1 Region: 468-625
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.3e-39
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 333-413
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000000249
Family WWE domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000038329
Domain Number - Region: 242-266
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00942
Family CCCH zinc finger 0.006
Further Details:      
 
Domain Number - Region: 270-324
Classification Level Classification E-value
Superfamily WWE domain 0.0334
Family WWE domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038329   Gene: ENSCAFG00000008875   Transcript: ENSCAFT00000043705
Sequence length 634
Comment pep:known_by_projection chromosome:CanFam3.1:23:50253695:50278561:1 gene:ENSCAFG00000008875 transcript:ENSCAFT00000043705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIHIMEMETTEPEPDCVVQPPSPPDDFSCQMRLSEKISPLKTCFKKKEQKRLGTGTLRSL
RPILNTLLESGSLDGVFRSRNQSADESSLHEPIVKKPLEISPSCPPTENSMSVLIPDGTN
VGGQIPEAHPSTDAPEQVVPIQDHSFPPETLSGTVADSTAGHFQTDLLHPVSTDVPASPD
CIDKVMDYIPGVFQDNNFTIQYILDTSDKLSTELFQDKSEEASLDLVFELVNQLQYHTHQ
ENGIEICMDFLQGTCIYGRDCLKHHTVLPYHWQIKRTTTQKWQSVSTDSQEHLERFYCNP
ENDRMRMKYGGQEFWADLNAMNVYETTEFDQLRRLSTPPSSNVNSVYHTVWKFFCRDHFG
WREYPESVIRLIEEANSRGLKEVRFMMWNNHYILHNSFFRREIKRRPLFRSCFTLLPYLQ
TLGGVPTQAPPPLEATSSSQIICPDGVTSANFYPETWVYMHPSQDFIQVPVSVEDKSYRI
IYNLFHKTVPEFKYRILQILRVQNQFLWEKYKRKKEYMNRKMFGRDRIINERHLFHGTSQ
DVVDGICKHNFDPRVCGKHATMFGQGSYFAKKASYSHNFSKKSSKGVHFMFLAKVLTGRY
TMGSHGMRRPPPDDDQSYPYFVIQYEEVSNTVSI
Download sequence
Identical sequences J9NYG0
ENSCAFP00000038329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]