SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038332 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038332
Domain Number 1 Region: 140-298
Classification Level Classification E-value
Superfamily PH domain-like 4.28e-33
Family Pleckstrin-homology domain (PH domain) 0.0000496
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily PH domain-like 1.94e-22
Family Pleckstrin-homology domain (PH domain) 0.00000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038332   Gene: ENSCAFG00000032414   Transcript: ENSCAFT00000045990
Sequence length 425
Comment pep:known_by_projection chromosome:CanFam3.1:16:26567737:26629953:-1 gene:ENSCAFG00000032414 transcript:ENSCAFT00000045990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTQANCLLWYMDNPQNLAVGAGAVGSLQ
LTYISKVSIATPKQKPKTPFCFVINALSQRYFLQANDQKDLKDWVEALNQASKITVPKVG
SLPLTTEVIKSLAAPPALEKKPQVAYKTEIIGGVVVHTPINQNGGDGQEGSEPGSHAILR
RSQSYIPTTGSRVPSGPPLIKSGYCVKQGNVRKSWKRRFFALDDFTICYFKCEQDREPLR
TIFLKDVLKTHECLVKSGDLLMRDNLFEIITSSRTFYIQADSPEDMHSWIKEIGAAVQAL
KCHPRDMSFSRSISLTRSGSSSHSGGPNSFLCRGRPPVEEKKALCKAPSVASSWQPWTPV
PQAGDKLLPAEETPGDSLLMSRLGESSTSGVLPSSRIRHRSEPQHPKEKPFLFSLDDESI
RTSDV
Download sequence
Identical sequences J9NYG3
9615.ENSCAFP00000008781 ENSCAFP00000038332 XP_005629900.1.84170 XP_539966.2.84170 ENSCAFP00000038332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]