SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038341 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038341
Domain Number 1 Region: 1250-1358
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-33
Family PDZ domain 0.0000042
Further Details:      
 
Domain Number 2 Region: 1656-1827
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.86e-26
Family Nucleotide and nucleoside kinases 0.0002
Further Details:      
 
Domain Number 3 Region: 1409-1504
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-18
Family PDZ domain 0.0063
Further Details:      
 
Domain Number 4 Region: 513-625
Classification Level Classification E-value
Superfamily PDZ domain-like 1.6e-16
Family PDZ domain 0.0021
Further Details:      
 
Domain Number 5 Region: 637-709
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-16
Family PDZ domain 0.025
Further Details:      
 
Domain Number 6 Region: 1513-1580
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000197
Family SH3-domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038341   Gene: ENSCAFG00000015499   Transcript: ENSCAFT00000050193
Sequence length 1828
Comment pep:known_by_projection chromosome:CanFam3.1:4:27688932:27779997:-1 gene:ENSCAFG00000015499 transcript:ENSCAFT00000050193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAWSCGRCRSSRHEKGSTYSVLSIMPSDSESSSSLSSVGTTGKAPSPPPLLTDRQVNEK
VENLSIQLRLMTRERNELRKRLAFATHGTTFDKRPYHRLNPDYERLKIQCVRAMSDLQSL
QKQHTNALKRCEEVAKETDFYHTLHSRLLSDQTQLKDDVDMLRRENGQLLRERNLLQQSW
EDMKRLHEEDQKEIGDLRAQQQQVLKLNGSSEILNKLYDTAMDKLEVVKKDYDALRKRYS
EKVAIHNSDLSRLEQLEEENQRLLKQTEMLTQQRDTAIQLQHQCALSLRRFEAIHHELNK
ATAQNKDLQWEMELLQSEMTELRTMQAKMAKESEKYKEERDAVYSEYKLIMSERDQVISE
LDKLQTEVELAESKLKSSTSEKKAASEEMEALRQIKDTVTMDAGRANKEAELLRKQCKAL
CQELKEALQEADVAKCRRDWAFQERDKIVAERDSIRTLCDNLRRERDRAVSELAEALRSL
DDTRKQKNDVSRELKELKEQMESQLEKEARFRQLMAHSSHDSAIDTDSMEWETEVVEFER
ETEDIDLKALGFDMAEGVNEPCLPGDCGIFVTKVDKGSIADGRLRVNDWLLRINDVDLIN
KDKKQAIKALLNGEGAINMVVRRRKSLGGKVITPLHINLSGQKDSGISLENGVYAAAVVP
GSPAAKEGSLAVGDRIVAINGIALDNKSLNECESLLRSCQDSLTLSLLKVFPQSSSWSGQ
NIFENIKDSDKMLSVRAHGPEVQAQNKRSLLQHNNSTQTDIFYADRLEDRRELGPPGGSS
SFLHKPFPGGPFPVSPQACPSASERSLSSFRSDASGERGYGLLDVRSRRPLLPFETEVGP
CGAAEAPLDKADPEGSNSGGTWPKAVLGSAAGPEKLSVYKKPKQRKSIFDPNTFKRPQTP
PKIDYLLPGPGSAHSPQPSKRVGPLTPPKPPRRSDSIKFQHRLETSSESEATLVGSSPST
SPPSALPPDVDPGEPTHTSPPRKGRVRIASSYYPEGDGDSSYLPAKKSCDGDLTSQKMDE
LGQKRRRPKSAPSFRPKLAPVVIPAQFLEEQKCIPASGELCPELQEWSPYSPGHSSRHSN
PPLYPGRASVGTVPRSMTPSTTVSSILRNPIYTVRSHRVGPCSSPPVPREVGPQGLHPSV
QHQGRLSLDLSHRSGSDYSDMRASHGSNSLPSSARLGSSSNLQFKAERIKIPSTPRYPRS
IVGSDRGSLSHSECSTPPQSPLNIDTLSSCSQSQTSASTLPRIAVNPAALGERRKDRPYV
EEPRHVKLQKGSEPLGISIVSGEKGGVYVSKVTGGSIAHQAGLEYGDQLLEFNGINLRSA
TEQQARLIIGQQCDTITILAQYNPHMHQLSSHSRSSSHLDPASTHAALQGSSAPTPEHPS
VIDPLMEQDEGPGTPQAKQSTPSSRMVGDANKKTPEPRVVFIKKSQLELGVHLCGGNLHG
VFVAEVEDDSPAKGPDGLVVGDLILEYGSLDVRNRTVEEVYVEMLKPKDSVRLKVQYRPE
EFTKVKGLPGDSFYIRALYDRLAEVEHELSFKKDDILYVDDTLPQGTFGSWMAWQLDENA
QKMQRGQIPSKYVMDQEFSRRLSMSEVKDDNNAAKTLSAAARRSFFRRKHKHKRSGSKDG
KDLLALDTFSNDTIPLFEDSVSLAYQRVQKVDCTSLRPVLILGPLLDVVKEMLVNEAPSK
FCRCPLEVMKASQQAIERGVKDCLFVDYKRRSGHFDVTTVASIKEITEKNRHCLLDIAPH
AIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLKDKVTQRHSKEQFETAQKIEQEYSRY
FTGVIQGGALSSICTQILAMVNQEQNKV
Download sequence
Identical sequences J9NYH2
ENSCAFP00000038341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]