SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038358 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038358
Domain Number 1 Region: 231-329
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-32
Family PDZ domain 0.00000733
Further Details:      
 
Domain Number 2 Region: 454-645
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.38e-28
Family Nucleotide and nucleoside kinases 0.0000973
Further Details:      
 
Domain Number 3 Region: 109-172
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-16
Family PDZ domain 0.022
Further Details:      
 
Domain Number 4 Region: 1-76
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000011
Family PDZ domain 0.0022
Further Details:      
 
Domain Number 5 Region: 353-426
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000302
Family SH3-domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038358   Gene: ENSCAFG00000015499   Transcript: ENSCAFT00000043010
Sequence length 648
Comment pep:known_by_projection chromosome:CanFam3.1:4:27688907:27721105:-1 gene:ENSCAFG00000015499 transcript:ENSCAFT00000043010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGFDMAEGVNEPCLPGDCGIFVTKVDKGSIADGRLRVNDWLLRINDVDLINKDKKQAIKA
LLNGEGAINMVVRRRKSLGGKVITPLHINLSGQKGSGPADAGGAPHSGISLENGVYAAAV
VPGSPAAKEGSLAVGDRIVAINGIALDNKSLNECESLLRSCQDSLTLSLLKPISRHRSPE
YDPEHHCFSVQHQGRLSLDLSHRSGSDYSDVMVPGEVRLRSPVCSHISPCWPYVEEPRHV
KLQKGSEPLGISIVSGEKGGVYVSKVTGGSIAHQAGLEYGDQLLEFNGINLRSATEQQAR
LIIGQQCDTITILAQYNPHMHQLSSHSRSRYQGLGVPGIRGQGRGFLRRLVLLYDRLAEV
EHELSFKKDDILYVDDTLPQGTFGSWMAWQLDENAQKMQRGQIPSKYVHLQGFSWRSAAL
STLGSIGGKKGRMDSVSLAYQRVQKVDCTSLRPVLILGPLLDVVKEMLVNEAPSKFCRCP
LGHVSRCLLFLSLEGRTAEVMKASQQAIERGVKDCLFVDYKRRSGHFDVTTVASIKEITE
KNRHCLLDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLKDKVTQRHSKEQFE
TAQKIEQEYSRYFTGVIQGGALSSICTQILAMVNQEQNKVLWIPACPL
Download sequence
Identical sequences J9NYI9
ENSCAFP00000038358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]