SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038416 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038416
Domain Number 1 Region: 231-302
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-18
Family SH3-domain 0.00062
Further Details:      
 
Domain Number 2 Region: 81-139
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.42e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.006
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000038416
Domain Number - Region: 327-363
Classification Level Classification E-value
Superfamily SH3-domain 0.00639
Family SH3-domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038416   Gene: ENSCAFG00000000201   Transcript: ENSCAFT00000044629
Sequence length 363
Comment pep:known_by_projection chromosome:CanFam3.1:10:1370673:1376886:-1 gene:ENSCAFG00000000201 transcript:ENSCAFT00000044629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKEVLESSKPSFPAETRQSGLQRLKQLFRKESPGTKEMELPPEPQANGEAVGAGGGPI
YYIYEEEEEEEEEEEPPPEPPKLVNDKPHKFKDHFFKKPKFCDVCARMIVLNNKFGLRCK
NCKTNIHEHCQSYVEMQRCFGKIPPGFHRAYSSPLYSNQQYACVKDLSAASHNDPVFETL
RTGVIMANKERKKGQADKKNPLAAVMEEEPEPARPEEGKPQDGNPEGDKKAEKKTPDDKH
KQPGFQQSHYFVALYRFKALEKDDLDFPPGEKITVIDDSNEEWWRGKIGEKVGFFPPNFI
IRVRAGERVHRVTRSFVGNREIGQIRKEGSQIVVQKGDEAGGYVKVYTGRKVGLFPTDFL
EEI
Download sequence
Identical sequences J9NYP7
ENSCAFP00000038416 ENSCAFP00000038416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]