SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038441 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038441
Domain Number 1 Region: 345-544
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-33
Family Pleckstrin-homology domain (PH domain) 0.0000886
Further Details:      
 
Domain Number 2 Region: 17-189
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-32
Family DBL homology domain (DH-domain) 0.0034
Further Details:      
 
Domain Number 3 Region: 176-293
Classification Level Classification E-value
Superfamily PH domain-like 3.85e-24
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038441   Gene: ENSCAFG00000004521   Transcript: ENSCAFT00000047548
Sequence length 546
Comment pep:known_by_projection chromosome:CanFam3.1:20:4992657:5027296:1 gene:ENSCAFG00000004521 transcript:ENSCAFT00000047548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFHGAVTRALDEIDQEGKDTLSREELRRGLSELPAIRDLHQGILEELGERLLHWEGQQKV
ADVFLAREQEFDHHAAHILQFDRYLSLLSETCLHSPRLAAAVREFEEQQSQQGGGQNVKH
RLLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNTQGALTLISKVTDRANDSMEQGENLQKL
VHIEHSVRGQGDLLQPGREFLKEGTLMKVTGKSRRPRHLFLMSDVLLYTYPQKDGKYRLK
NTLSVASMKVSRPVMEKVPYALKIETPQSCLTLSASSCAERDEWHSCLSRALPEDYKAQA
LAAFHHSVEIRERLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLRRHHCHACGKIVCRN
CSRNKYPLKYLKDRMAKVCDGCYGELKKRQHRNCGSERPVSMSFPLSSPRFSSSAFSSVF
HSINPSTFKKQKKVPSALTEVAASGEGSAISGYLSRCKKGKRHWKKLWFVIKGKVLYTYM
ASEDTVAMESMPLLGFTIAPEKEEGSSEVGPIFHLYHKKTLFYSFKAEDTNSAQRWIEAM
EDASVL
Download sequence
Identical sequences J9NYS2
ENSCAFP00000038441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]