SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038449 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038449
Domain Number 1 Region: 858-1069
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-55
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 1232-1418
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-26
Family Pleckstrin-homology domain (PH domain) 0.00000889
Further Details:      
 
Domain Number 3 Region: 1058-1178
Classification Level Classification E-value
Superfamily PH domain-like 4.78e-25
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038449   Gene: ENSCAFG00000006273   Transcript: ENSCAFT00000046550
Sequence length 1422
Comment pep:known_by_projection chromosome:CanFam3.1:15:35055469:35162224:-1 gene:ENSCAFG00000006273 transcript:ENSCAFT00000046550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSAAEIKKPPVAPKPKFVVANKPAPPPVAPKPDIVISGVPQPTKKTKPAIAPKPKVLKG
SSVRDIGQSPSRKIIVNLEEHKQELPENADNSNCKNVGHQSSDYILPVCSCNSQCIHKLG
NRESLFGKQLILEPLEMHENLENSKIDESSSAIKTRSKCDSNVENIKTQTGVVLKANILE
EKLKDVLTQRTSPFISLQKHRSTDNPEMNDGYNSNRQFRIEFADLSPSLSSFEKVPDHHR
CHLQLPNDETYQHTSEKSNTCFHSSEQETLENDGKRSTFLPSGGVSKKSEVKDLGPLEIH
LVPYTPKFPTPKPRKTRAARLLRQKYIDVPSESTEEPGNLDSNSSCLLDAALKNNKISIL
HQNVLCNQERVDKVKPGNKGELNVDSNGDRQHLVNPQKAMHHETSSFEKMETDSNLCSDS
KTVDGSSMSLAVDKGTNFIRCSTLSMSLPKQLKLTCNEHLPTTCNLGVSASQMQKESTIK
GESSSRIVPKKPQRHSLPAAGVLKKAASEELVEKSSYPSNEENNSEKGLERNHLQHLCAQ
NLNMSSSFDMPKRASEKPVWKLPHPILPFSGNPESLKSVTISSNSELSTAMTKPRAKSLS
AMDAERCTKPCKDTQKKNSLKKLLNMKLSICFMKSDFQKFWFKNSQLGDTTTGSLSGGEK
KGIESDWHGMLVEEKRSKPIKAYSADNYSLESQKKRKSRGHTSAANGPRAESLDDQMLSR
ESSSQGPCKSTTSGCAPEYENVRHYEEIPEYENLPFIMAIGKTPELERQNSRSMEDNDAN
VYEVEEPYEAPDGQLQLGPRHQHSSSGASQEGHNDLGLGLGELPSDEEEDINSSDEDDVS
SDSSKGDPDLGDKQDEDTGMKSKVHHIAKEIMSSEKVFVDVLKLLHIDFRDAVAHASRQL
GKPVIEDRILNQILYYLPQLYELNRDLLKELEERMSNWTEQHRIADIFVKKGPYLKMYST
YIKEFDKNIALLDEQCKKNPAFAAVVRDFEMSPRCANLALKHYLLKPVQRIPQYRLLLTD
YLKNLLEDSGDYRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYSLNGHHEIVQPGR
VFLKEGTLMKLSRKVMQPRVFFLFNDALLYTTPVQSGMYKLNNMLSLAGMKVRKPTQEAY
QNELKIESVERSFILSASSATERDEWLEAISRSIEEYAKKRITFCPSRSLDEADSENKEE
VSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKYGLDYLKNQ
PARVCEHCFQELQKLDHQHSPKIGSPGNHKSPSSTLSSVLHSIPSGRKQKKIPAALKEVS
ANTEDSSMSGYLYRSKGNKKPWKHLWFVIKNKVLYTYAASEDVAALESQPLLGFTVTQVK
DENSESRVFQLLHKNMLFYVFKADDAHSAQKWIEAFQEGTIL
Download sequence
Identical sequences J9NYT0
XP_854794.2.84170 ENSCAFP00000038449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]