SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038456 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038456
Domain Number 1 Region: 625-689,896-1209
Classification Level Classification E-value
Superfamily Ras GEF 4.58e-109
Family Ras GEF 0.000018
Further Details:      
 
Domain Number 2 Region: 224-447
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-43
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 3 Region: 36-132
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000211
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 
Domain Number 4 Region: 435-590
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000201
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038456   Gene: ENSCAFG00000008744   Transcript: ENSCAFT00000044935
Sequence length 1210
Comment pep:known_by_projection chromosome:CanFam3.1:3:26055173:26286819:-1 gene:ENSCAFG00000008744 transcript:ENSCAFT00000044935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSVRYNEGHALHLAFLARKEGTKREKMSKRAAEASRWHEKWFALYQNVLFYFEGEQSG
RPAGMYLLEGCSCERTPAPPRAGVGPPGARDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRIMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIEEPDASDDDS
KGSGQVFGHLDFKIVVEPPDSAPFTVVLLAPSRQEKAAWTSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLAKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLVDGKSPR
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSRIGALDLTTCSASSSPTATHSPAASPP
PHTGKVPLDLSRGLPSPEQSPGSVEEHVDNPRMDLCNKLKRSIQRAVLESVPVDRAGVEG
SPAVDSTDLSPCRSPSTPQHLRYRQPPGQTADNSHCSVSPASAFAIATAAAGHGSPPGFN
NTERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLP
QERKATANILRALSQDDQDDIHLKLEDIIQLTDCPKAECFETLSAMELAEQITLLDHIIF
RSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWV
AVADICRCLHNYNGVLEITSALNRSAIYRLKRTWAKVSKQTKALMDKLQKTVSSEGRFKN
LRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQT
CYRIDHQPKV
Download sequence
Identical sequences J9NYT7
ENSCAFP00000038456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]