SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038494 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038494
Domain Number 1 Region: 34-267
Classification Level Classification E-value
Superfamily PH domain-like 6.39e-87
Family SSRP1-like 0.00000495
Further Details:      
 
Domain Number 2 Region: 381-461
Classification Level Classification E-value
Superfamily HMG-box 3.53e-26
Family HMG-box 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038494   Gene: ENSCAFG00000007947   Transcript: ENSCAFT00000049552
Sequence length 551
Comment pep:known_by_projection chromosome:CanFam3.1:18:38802921:38811707:1 gene:ENSCAFG00000007947 transcript:ENSCAFT00000049552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYP
TFLHLHGKTFDYKIPYTTVLRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKD
EDISLTLNMNEEEVEKRFEGRLTKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQC
ITCSYKASSGLLYPLERGFIYVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQ
YTFSSIEREEYGKLFDFVNAKKLNIKNRGLKEGMNPSYDEYADSDEDQHDAYLERMKEEG
KIREENANDSSDDSGEETGRLALAVPGHESVPLLGRFDSNASASSSSNEGDSDRDEKKRK
QLKKAKMAKDRKSRKKPVEVKKGKDPNAPKRPMSAYMLWLNASREKIKADHPGISITDLS
KKAGEIWKGMSKEKKEEWDRKAEDARREYEKAMKEYEGGRGESSKRDKSKKKKKVKVKME
KKSTPSRGSSSKSSSRQLSESFKSKEFVSSDESSSGENKSKKKRRRSEDSEEEELASTPP
SSEDSASGSDE
Download sequence
Identical sequences J9NYX4
ENSCAFP00000038494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]