SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038547 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038547
Domain Number 1 Region: 7-292
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-80
Family Protein kinases, catalytic subunit 0.00000419
Further Details:      
 
Domain Number 2 Region: 706-893
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.08e-50
Family Nucleotide and nucleoside kinases 0.0000000359
Further Details:      
 
Domain Number 3 Region: 548-696
Classification Level Classification E-value
Superfamily SH3-domain 9.58e-35
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 468-566
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-21
Family PDZ domain 0.0000162
Further Details:      
 
Domain Number 5 Region: 336-387
Classification Level Classification E-value
Superfamily L27 domain 1.77e-19
Family L27 domain 0.0000947
Further Details:      
 
Domain Number 6 Region: 397-448
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000441
Family L27 domain 0.0000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038547   Gene: ENSCAFG00000014358   Transcript: ENSCAFT00000049479
Sequence length 897
Comment pep:known_by_projection chromosome:CanFam3.1:X:35940950:36296928:-1 gene:ENSCAFG00000014358 transcript:ENSCAFT00000049479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKCTSSPGLSTEDLK
REASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASH
YMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRV
GTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPR
QWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNA
RRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGAVSQVLDSLEEIHALTDCSEK
DLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPENNDAK
ELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVT
RVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVAN
QTVEQLQKMLREMRGSITFKIVPSYRTQSSSCEDLPSTTQPKGRQIYVRAQFEYDPAKDD
LIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSPELQEWRVACIAMEK
TKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHG
VGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYG
SHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAPTITPGLNED
ESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY
Download sequence
Identical sequences J9NZ27
XP_861626.1.84170 ENSCAFP00000038547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]