SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038597 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038597
Domain Number 1 Region: 11-157
Classification Level Classification E-value
Superfamily Serpins 3.14e-38
Family Serpins 0.0000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038597   Gene: ENSCAFG00000025512   Transcript: ENSCAFT00000049637
Sequence length 189
Comment pep:known_by_projection chromosome:CanFam3.1:35:3239853:3263311:-1 gene:ENSCAFG00000025512 transcript:ENSCAFT00000049637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEVLIILGACVQHETGTLTMDTLSEANGTFAISLLKKLGEDGSKNVFFSPMSISSALSM
VFMGAKGNTAAQMSQTLSLSKSGGGGDVHQGFQALLNEVNSAEARYLLRTANRLFGEKTC
GFLSSFKDSCRTFYQAEMEELDFLSACEQSREHITAGVTEGRKVKTRGGSVLRVSLRPRR
PPFHKATDT
Download sequence
Identical sequences J9NZ77
ENSCAFP00000038597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]