SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038630 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038630
Domain Number 1 Region: 142-440
Classification Level Classification E-value
Superfamily RNI-like 4.24e-46
Family Cyclin A/CDK2-associated p19, Skp2 0.0066
Further Details:      
 
Domain Number 2 Region: 64-115
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000222
Family F-box domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038630   Gene: ENSCAFG00000031644   Transcript: ENSCAFT00000045620
Sequence length 449
Comment pep:known_by_projection chromosome:CanFam3.1:4:87348125:87485086:-1 gene:ENSCAFG00000031644 transcript:ENSCAFT00000045620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDLSMRTLSTPSPALSCAPGAPGGCQNGRGSSTSSSSVTGETVALVHAPPPPRLTHPLIR
LAARPQREQARVERLPDACLVRVFSFLRTDQLCRCARVCRRWYNVAWDPRLWRAIRLAGA
GLHADRALRVLTRRLCQDTPNVCLLLETVAVSGCRRLTDRGLYTLAQCCPELRRLEVAGC
HNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIQLSPLHGKQISIRYLDMTDC
FALEDEGLHTIAAHCTRLTHLYLRRCARLTDEGLRYLVIYCSSLRELSVSDCRCISDFGL
REIAKLEARLRYLSIAHCGRVTDVGIRYVARYCGKLRYLNARGCEGITDHGVEYLAKHCA
RLKSLDIGKCPLVSDSGLECLALNCFNLKRLSLKSCESITGRGLQIVAANCFDLQMLNVQ
DCDVSVEALRFVKRHCRRCVIEHSNPAFC
Download sequence
Identical sequences J9NZB0
ENSCAFP00000038630 ENSCAFP00000038630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]