SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038660 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038660
Domain Number 1 Region: 228-374
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-39
Family Third domain of FERM 0.00062
Further Details:      
 
Domain Number 2 Region: 126-230
Classification Level Classification E-value
Superfamily Second domain of FERM 4.32e-36
Family Second domain of FERM 0.0000673
Further Details:      
 
Domain Number 3 Region: 40-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.65e-24
Family First domain of FERM 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038660   Gene: ENSCAFG00000004855   Transcript: ENSCAFT00000049397
Sequence length 505
Comment pep:known_by_projection chromosome:CanFam3.1:19:29985792:30063216:-1 gene:ENSCAFG00000004855 transcript:ENSCAFT00000049397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSFFRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLLDGTDVSVDLP
KKAKGQELFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRV
KFYSSEPNNLREELTRYLFVLQLKQDILSGKLECPFDTAVQLAAYNLQAELGDYDLAEHS
PELVSEFRFVPIQTEEMELAIFEKWKEYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKAR
DGNDYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKNKLTLVVVEDDVQGKEQEHTFV
FRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQTTKTNK
ARRSTSFERRPSKRYSRRTLQMKASTAKPEELSVHNNVSTQSNGSQQAWSVRSTLPVIPS
VPSGPVLAEIESLPRNPGSNQYDRKWVSAASDCCQRGGNQWNTRALSPPQPAHRNYTDFV
HEHNVKNTGVHHDVHFPGHAAMTEI
Download sequence
Identical sequences J9NZE0
ENSCAFP00000038660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]