SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038680 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038680
Domain Number 1 Region: 412-609
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.59e-48
Family Nucleotide and nucleoside kinases 0.000099
Further Details:      
 
Domain Number 2 Region: 210-341
Classification Level Classification E-value
Superfamily SH3-domain 2.27e-23
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 162-246
Classification Level Classification E-value
Superfamily PDZ domain-like 8.28e-20
Family PDZ domain 0.0012
Further Details:      
 
Domain Number 4 Region: 96-147
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000306
Family L27 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038680   Gene: ENSCAFG00000023403   Transcript: ENSCAFT00000047746
Sequence length 613
Comment pep:known_by_projection chromosome:CanFam3.1:9:19477475:19507446:1 gene:ENSCAFG00000023403 transcript:ENSCAFT00000047746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNILHGAATPLTLLLPESAGRALELTSTDMPVLSEDSGLHETLALLTSQLRPDSNHKEEM
GFLRDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAMALAEDVMEELQAASVHSDEREL
LQLLSTPHLRAMLMVHDTVAQKNFDPVLPPLPDNIDEDFDEESVKIVRLVKNKEPLGATI
RRDEHSGAVVVARIMRGGAADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSIT
LKIIPATQEEDRLKDSKVFMRALFHYNPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWW
QAKRVGDTNLRAGLIPSKQFQERRLSYRRATGTLPSPQNLRKPPYDQPCDKEACDCEGYL
KGHYVAGLRRSFRLGRRERLGSPQEGKASVVAESPELLTYEEVTRYQHQPGERPRLVVLI
GSLGARLHELKQKVVAENPQHFGVAVPHTTRPRKSHEKEGVEYHFVSKQAFEADLHHNKF
LEHGEYKENLYGTSLDAIQSVMAKNKVCLVDVEPDALQQLRTSEFKPYVIFVKPAIQEKK
TPPMSPTCEDTATPLDEEQQEMAASAAFIDQYYGHLVDSVLVKQDLQSAHSQLRVLLEKL
SKDTHWVPVSWVR
Download sequence
Identical sequences J9NZG0
ENSCAFP00000021285 ENSCAFP00000038680 XP_005624476.1.84170 XP_013972010.1.84170 XP_013972011.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]