SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038683 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038683
Domain Number 1 Region: 6-123,187-302
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.1e-49
Family Adenylyltransferase 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038683   Gene: ENSCAFG00000013252   Transcript: ENSCAFT00000046334
Sequence length 307
Comment pep:known_by_projection chromosome:CanFam3.1:7:16632206:16781239:-1 gene:ENSCAFG00000013252 transcript:ENSCAFT00000046334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTETTKTHVILLACGSFNPITKGHIQMFERARDYLHKTGRFIVIGGIVSPVHDSYGKQGL
VSSRHRLIMCQLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTP
SMTPVIGQPQNETPQPIYQNSNVSTKPTAAKILGKVGESLSRICCVRPPVERFTFVDENA
NLGTVMRYEEIELRILLLCGSDLLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADTDRI
MNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQ
LYINASG
Download sequence
Identical sequences A0A2I2V4G1 J9NZG3
XP_010638851.1.5607 XP_011289298.1.62641 XP_013970600.1.84170 XP_013970601.1.84170 XP_019282957.1.44245 ENSFCAP00000017657 ENSCAFP00000038683 ENSCAFP00000038683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]