SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038684 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038684
Domain Number 1 Region: 79-190
Classification Level Classification E-value
Superfamily SH2 domain 9.27e-32
Family SH2 domain 0.0000288
Further Details:      
 
Domain Number 2 Region: 199-265
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-22
Family SH3-domain 0.00044
Further Details:      
 
Domain Number 3 Region: 50-91
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000205
Family SH3-domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038684   Gene: ENSCAFG00000029170   Transcript: ENSCAFT00000044118
Sequence length 267
Comment pep:known_by_projection chromosome:CanFam3.1:5:41014076:41040385:1 gene:ENSCAFG00000029170 transcript:ENSCAFT00000044118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLLPVSPPSGAASKEQRALKTKEDSPPLQRKQEEPTLLGAQLLGPGDSAMESVALYSFQ
ATESDELAFNKGDTLKILNMEDDQNWYKAELRGAEGFIPKNYIRIKPHPWYSGRISRQLA
EEILMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFLWEEKFNSLNE
LVDFYRTTTIAKQRQVFLRDEEPLVKSPRACFAQAQFDFSAQDSSQLSFHHGDIIEVLEH
LDPHWWRGRLGGRIGFFPRSYVQPVQL
Download sequence
Identical sequences J9NZG4
ENSCAFP00000038684 ENSCAFP00000038684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]