SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038709 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038709
Domain Number 1 Region: 445-507
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-24
Family SH3-domain 0.00039
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000038709
Domain Number - Region: 48-104
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.01
Family SNARE fusion complex 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038709   Gene: ENSCAFG00000012817   Transcript: ENSCAFT00000047789
Sequence length 513
Comment pep:known_by_projection chromosome:CanFam3.1:37:12162815:12274083:1 gene:ENSCAFG00000012817 transcript:ENSCAFT00000047789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKLQMLLEEEIPGGHGGLFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLAS
VAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSR
THKIIAPANLERPVRYIRKPIDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQK
PPSPPMSGKGTLGRHSPYRTLEPVRPPVVPNDYVPSPTRNMAPSQQSPVRTASVNQRNRT
YSSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPSVFPAPAGSAGTPPLPATSAS
APAPLVPATVPSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRH
TPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYSQNPVSDTPPPPPPVEEPVFDESPPPP
PPPEDYEEEEAAVVEYSDPYAEEDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYV
IKKNDDGWYEGVMNGVTGLFPGNYVESIMHYSE
Download sequence
Identical sequences J9NZI9
XP_545606.2.84170 ENSCAFP00000038709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]