SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038755 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038755
Domain Number 1 Region: 6-136
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.67e-25
Family G proteins 0.00000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038755   Gene: ENSCAFG00000012631   Transcript: ENSCAFT00000020069
Sequence length 179
Comment pep:novel chromosome:CanFam3.1:33:28410389:28410953:-1 gene:ENSCAFG00000012631 transcript:ENSCAFT00000020069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTIKCVVGDGAVGKTCLLVSYTTRKFPECVPTFFVNYAVTGLFDPAGQEDYGRPRPLSS
HKHVFLACLSGASPPSFENVKEKWVPEVTRHCPKTPFLLVGTQIDLRDDPSTTEKLAKNT
QKPVPAETAEKLARGLRPSRSGAPRPHTQGLGGVFDGAVWAALEPPDRRRAAAVRCCAH
Download sequence
Identical sequences J9NZN5
ENSCAFP00000038755 ENSCAFP00000038755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]