SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038826 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCAFP00000038826
Domain Number - Region: 341-405,439-539
Classification Level Classification E-value
Superfamily ARM repeat 0.0236
Family MIF4G domain-like 0.08
Further Details:      
 
Domain Number - Region: 84-130,157-194
Classification Level Classification E-value
Superfamily PH domain-like 0.0899
Family Pleckstrin-homology domain (PH domain) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038826   Gene: ENSCAFG00000013490   Transcript: ENSCAFT00000048252
Sequence length 934
Comment pep:known_by_projection chromosome:CanFam3.1:7:18019789:18176586:-1 gene:ENSCAFG00000013490 transcript:ENSCAFT00000048252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGSASSLLDEGKCTYIRGKTEATIKNFSPFYSRQYAVAFCNHVRSEVEQQRDLTSQFLK
TKPPLEPGTVLYEAELSQFAEDIKKWKERYIVIKNDFAVESYENKEAYQRGVAPKSRILP
AGGKVLTSENEYNLLSDRFFPDPLAPSEKENAQPFVVLPKEFPVYLWQPFLRHGYFCFHE
ATDQKKFSALLSDCIRHLNHDYTKQMTFEAQAFLEAVQFFRQEKGHYGSWEMITGDEVQI
LSNLVMEELLPTLQTDLLPKMKGKKNDRKRAWFGLLEDAYNLVQHQVSEGLSTLKEECRT
LTKGLEGTIRSDMDQIVNSKNFLIGKIKAMVAQPAERSCAESVQPFLASILEELMGPVSS
GFSEVRSLFEKEVDELSQKFQTTKDSAQLKEHLGQLMNLPLDSLKMEPCYSKVNLLQERL
QDLKSRFRFPHVDLVVQRTQNYMQELMENAVFTFEQLLSPHLQGETSKTAVAIEKVKLRV
LKQYDYDSSTIRKRIFQEALVQITLPTVQKALASTCKPELQKYEQFIFADHTNMIHVENV
YEEILHQSLLDETLKVIKEAAILKKHNLFEDNMALPSESVSSLTDIKTSAGSNQASPARR
ASALLPGVSDSETLSNEVFQESGEKKQPGVSSPLAKEESLSFPVPTPPPVGTGQMIISGM
DGPLVDLVTAEDTAGALGTHSSELEFGGAPKDGEPTHEKPESSSASSSLKELRNLLTVTI
EVPVESSTLEIEEDTNEETLAPQEMEKLEETTPTYTEANQAAASSQDSCEESEISGREAH
PPPLEAEASREELGGFLGAELAREGLNPGASSPDPTEQQAEAGEPTEGEIQGRSSSLDAQ
DERGAASIVEDEARPQEDCTSGAHHTCPSESPVSVEETLGGTSSMTQATTSVKTEEIKAA
GVHECQWVVENAPNIDLLGSPDLGESTPEQPSEE
Download sequence
Identical sequences J9NZV5
ENSCAFP00000038826 XP_537163.2.84170 ENSCAFP00000019862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]