SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038841 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038841
Domain Number 1 Region: 69-164
Classification Level Classification E-value
Superfamily F-box domain 8.37e-18
Family F-box domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038841   Gene: ENSCAFG00000000029   Transcript: ENSCAFT00000049738
Sequence length 429
Comment pep:known_by_projection chromosome:CanFam3.1:1:5182244:5222277:1 gene:ENSCAFG00000000029 transcript:ENSCAFT00000049738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGRGRLLLQHWRGLLALHWPPGGVGAAPGLAGEAPGPAGFRKRPGTSYAGTATLKQCA
RRGRHYKQPSADHPASLESMPSEILLKIFSYLDAVTLLCTGCVNRRFYHLANDNFIWIRI
YSTAFSPKISNWQVNSAEKTTVSMNLLSVEDKEAGYWKKEYIAKQRASVKAALARVLKPV
NPYTGLPVKTKEALRISGLGWVIILKEKNGKEYIMQHIDLLINDSSVTIIWYGRNWPQLA
TLSTLDLCGVTPVFRDRSKPPSKNGPRWLSLIAKYNLSNLTESTMIGWDRLIRIFCLHPG
LLVGLWKREEELAFVMANLHFHHLVEKSTLGSATVPYELPPHTPLLDDNPEYGLHGYQLH
VDMHSGGVFYLCGTFRNLFTKKGSIENGYVKLVVIRFKNNTEHLPLIGXXXXXXXXXXXX
XXXXXXXXX
Download sequence
Identical sequences J9NZX0
ENSCAFP00000038841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]