SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038890 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCAFP00000038890
Domain Number - Region: 210-242
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 0.0301
Family Transcription factor STAT-4 N-domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038890   Gene: ENSCAFG00000031607   Transcript: ENSCAFT00000048115
Sequence length 422
Comment pep:known_by_projection chromosome:CanFam3.1:33:7947891:7949159:1 gene:ENSCAFG00000031607 transcript:ENSCAFT00000048115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVFLKMNGSIILRSLARFLVPFTIPRKRRVLCSGVLQRYLSSKIPAVSYPNKESTSPPE
KLELDSWKITMKSSVQDVSADSGSKDEDPVVAMKELIEMWRLLGREVPEHISEEELKTAM
ECVSKSSKKKYLRYLYIKEKAKKARQTKKELKAATKEKAIKDQLLETTKEDKQQNFLFLR
LWDRNMDTAMGWKGAQAMQFGQPLVFDMDYGNYMKPKELRNTVCQLLESEGWNRRDVDPF
HIYFCNLQVGGVYHKELVRRYEEKWSKLLLTTTEKSYIDLFPKDSIIYLTADSPNVMTTF
KHDKIYVVGSFVDKGTQKGISLAKAKRLKLATECLPLDRYLQWDTGTKNLTLDQMMRILL
CLKNTGSWEEALRFVPKRKHAGYLEISPSSQEELVNRLKRSKTFNSFPKDSLKIHTQKRW
LK
Download sequence
Identical sequences J9P019
ENSCAFP00000038890 XP_005639483.1.84170 XP_005639484.1.84170 XP_535722.3.84170 ENSCAFP00000038890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]