SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039002 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039002
Domain Number 1 Region: 128-513
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.99e-164
Family Myotubularin-like phosphatases 0.000000000000578
Further Details:      
 
Domain Number 2 Region: 3-126
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-44
Family GRAM domain 0.000000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039002   Gene: ENSCAFG00000004092   Transcript: ENSCAFT00000043114
Sequence length 571
Comment pep:known_by_projection chromosome:CanFam3.1:21:5242521:5317007:1 gene:ENSCAFG00000004092 transcript:ENSCAFT00000043114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPPLLPGENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYFKSMERDPPFVLDASLGVI
SRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPL
FAFEYKEIFPENGWKLYDSLLEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPD
EELKRVASFRSRGRIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQ
SHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYP
NIEETHWLSNLESTHWLEHIKLILAGALRIADKIESGKTSVVVHCSDGWDRTAQLTSLAM
LMLDGYYRSIRGFEVLIEKEWLSFGHRFQLRLGHGDKNHADADRSPVFLQFIDCVWQMTR
QFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEHQRGKENLPKRTVSLWSYINSQLEDFT
NPLYGSYSNHVLYPVASMRHLELWVGYYVRWNPRMKPQEPIHNRYKELLAKRAELQKKVE
ELQREISNRSTSSSERASSPAQCVTPVQTVV
Download sequence
Identical sequences J9P0D0
ENSCAFP00000039002 XP_005633385.1.84170 XP_005633386.1.84170 XP_005633387.1.84170 XP_005633388.1.84170 XP_013977931.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]