SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039058 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039058
Domain Number 1 Region: 305-435
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-33
Family Ran-binding domain 0.00000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039058   Gene: ENSCAFG00000018711   Transcript: ENSCAFT00000046391
Sequence length 483
Comment pep:known_by_projection chromosome:CanFam3.1:4:72248396:72310757:1 gene:ENSCAFG00000018711 transcript:ENSCAFT00000046391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTIQRKGSSHLFDSLSTCKLKFPEDQRQQEKSVIAQPIFVFAKREQTFKRPAEDSTYEA
SEHECNGFLRKRVRSSSFTLHTTHPQSPGASSLSQNRMRSSSFTNLLTFPPSGPVKKNNV
FMTSSLVQRNADMNSTEQGPVKHSEHVLRPAILQPPQAQRCEKVRKTFGHNSLEACKTKE
KTKNKISEGNSCLLSENLPSARISVQLTTNQNCLGATSVGCQPNEDKYSFKSCSSDFVFG
ENMVERVLDTQNLTQPQLENDSHTEEKPFKSTLEFPVTSPNSSTHSIQRISLIESAAAFS
SKPSPKCLLEKIDVVTGEEAEHNVLKINCKLFIFNKTTQSWIERGRGALRLNDTASSDCG
TFQSRLIMRNQGSLRLILNSKLWTQMEIQRANHKNLRITATDLEDYSIKVFLIQASAKDT
GCLYAAIHHRLVALRSFDKQKDLNQAESQSETILQQLNCESCDEDEDDFIQVTKNRSACI
ERL
Download sequence
Identical sequences J9P0I5
ENSCAFP00000039058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]