SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039159 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039159
Domain Number 1 Region: 116-240
Classification Level Classification E-value
Superfamily PH domain-like 5.32e-19
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 
Domain Number 2 Region: 33-61
Classification Level Classification E-value
Superfamily WW domain 0.0000668
Family WW domain 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000039159
Domain Number - Region: 5-33
Classification Level Classification E-value
Superfamily WW domain 0.000712
Family WW domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039159   Gene: ENSCAFG00000013770   Transcript: ENSCAFT00000048682
Sequence length 317
Comment pep:known_by_projection chromosome:CanFam3.1:9:18188915:18198724:1 gene:ENSCAFG00000013770 transcript:ENSCAFT00000048682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPRPTSPLAAPPGWSCHVSPEGQTLYTNHYTQEQWVRLEDQHGKPYFYNPEDTSVQWELP
QVPVPAPRSICRSNQDSETPAQASPPEEKVREGMREVGNWEKISPPGLLSKIKTLDKAGV
LHRTKTVDKGKRLRKKHWSASWTVLEGGVLTFFKDSKASAAGGLRQPPKLSTPEYTVELR
GASLSWAPKEKSSRKNVLELQSRDGSEYLIQHDSEAIISTWHKAISEGIQEVSADLPPEE
ESQSSGADFGSSERLGSWREDEARLGAGCPGPGAAAAEGDLSKVRHRLRKFLLKRPTLQS
LREKGYIQDQVFGCPLA
Download sequence
Identical sequences J9P0T6
ENSCAFP00000039159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]