SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039176 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCAFP00000039176
Domain Number - Region: 404-442
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.035
Family Nuclear receptor ligand-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039176   Gene: ENSCAFG00000006413   Transcript: ENSCAFT00000043331
Sequence length 629
Comment pep:known_by_projection chromosome:CanFam3.1:27:793043:843695:-1 gene:ENSCAFG00000006413 transcript:ENSCAFT00000043331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTSAYQHKLAEKLTILNDRGQGVLIRMYNIKKTCSDPKSKPPFLLEKSMESSLKYINK
KFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFD
INLNFDFTQSYLDLIVTYTSVILLLSRIEDRRVLIGMYNCAHEMLHGHSDPSFARLGQMV
LEYDHPLKKLTEEFGPHTKAVSEALLSLHFLFVRRNQGAEQWRSAQLLSLISTPPAMINP
ANSDTMACEYLSVEVMERWIIIGFLLCNGCLNSNSQCQKLWKLCLQGSLYITLIREDVLQ
VHKVTEDLFSSWKGYGKRVADIKESKEHVIANSGQFHCQRRQFLRMAVKELETVLTDEPG
LLGPKALYVFMALSFIRDEVTWLVRHTENVTKTKTPEDYADSSIAELLFLLEEIRALVRR
HIKVIQQYHLQYLARFDALVLSDIIQNLSVCPEEESIIMSSFVSTLSSLNLKQVDSGEKF
EFSGLRLDWFRLQAYTSVAKAPLHLHENPDLAKVMNLIVFHSRMLDSVEKVLVETSDLST
FCFHLRTFEKMFTMTLEEPTMLRYAIAFPLICAHFVHCTHEMCPEEHHPPSSPCPPPLET
SGAWAERAHVPAALPGSLNPHCVSAKQEL
Download sequence
Identical sequences J9P0V3
ENSCAFP00000039176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]