SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039233 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039233
Domain Number 1 Region: 16-145
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000392
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039233   Gene: ENSCAFG00000011169   Transcript: ENSCAFT00000043850
Sequence length 471
Comment pep:known_by_projection chromosome:CanFam3.1:28:24643833:24705020:1 gene:ENSCAFG00000011169 transcript:ENSCAFT00000043850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPKPQKSPGKRFTFYYENEVCKQDYFIKSPPPQLFFSASSWKKRFFILSKSGERSLCLS
YYKNQHHRGSIKIDRNSSVEVGISSHEKMQSVHKMFKCCSDEVMSIRTTNREYFLIGHDR
EKIKDWVSFVSSFCWDVEAARQDTEEKFSSGDKRPSSDPSPLFDPSSTLEAVTRGCQTPR
NSLPDVHLMGKKSPGLRQAHLPHDFLSETTEDTEEESHYISPQSILSELDSFIASSDSGE
SPEPGSPDQFIERTEHHYMSMKSCFFRETSHESADNKEESQALPEIQNERLHLQEQGSQK
DSCLPPANMEAQTTNDRKELASLTVVQLSILINNIPDEDQVEKLSVFLSPSDIINYLTLT
EAAGRICVAQWQGPPRLGCIFSHGDHLLAVNDLKPQGLDEASLFLSRSVKKEWFFWSERI
LDAVKRQDTCTPMFLAAMSTIAKLWKGPRCPSKDEWIKKMWDVYNGILLSH
Download sequence
Identical sequences J9P110
ENSCAFP00000016445 ENSCAFP00000039233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]