SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039234 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039234
Domain Number 1 Region: 5-269
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.68e-62
Family Adenylyltransferase 0.000000000837
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039234   Gene: ENSCAFG00000032251   Transcript: ENSCAFT00000047631
Sequence length 279
Comment pep:known_by_projection chromosome:CanFam3.1:5:63123430:63156597:1 gene:ENSCAFG00000032251 transcript:ENSCAFT00000047631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENSKMEVVLLACGSFNPITNMHLRLFELAKDYMNGTGKYKVIKGIISPVGDAYKKKGLI
SAHHRVIMAELATKSSEWVEVDTWESLQKEWVETAKVLRHHQEKLEAGSCDHQQDSPVRG
RPGQKRKWAEQRQDFSQKKSLEPKTKDVPKVKLLCGADLLESFGVPNLWKSEDITQIVGD
YGLVCITRAGNDAQKFIYESDALWQHRNNIHLVNEWITNDISSTKIRRALRRGQSIRYLV
PDLVQEYIEKHDLYSCESEERNVGVILAPLQRNTAEANS
Download sequence
Identical sequences J9P111
XP_003639109.1.84170 XP_005620577.1.84170 XP_005620578.1.84170 XP_005620579.1.84170 ENSCAFP00000039234 ENSCAFP00000039234 9615.ENSCAFP00000029234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]