SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039250 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039250
Domain Number 1 Region: 215-556
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.27e-131
Family Mammalian PLC 0.00000000116
Further Details:      
 
Domain Number 2 Region: 795-858,899-1041
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 1.7e-65
Family C-terminal domain of PLC-beta 0.0000791
Further Details:      
 
Domain Number 3 Region: 46-213
Classification Level Classification E-value
Superfamily EF-hand 1.44e-53
Family EF-hand modules in multidomain proteins 0.00000646
Further Details:      
 
Domain Number 4 Region: 576-694
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.81e-25
Family PLC-like (P variant) 0.0000707
Further Details:      
 
Domain Number 5 Region: 1-44
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000197
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039250   Gene: ENSCAFG00000005856   Transcript: ENSCAFT00000046106
Sequence length 1072
Comment pep:known_by_projection chromosome:CanFam3.1:24:13337234:13587167:-1 gene:ENSCAFG00000005856 transcript:ENSCAFT00000046106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITVVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKL
QVTPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCP
RPEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPN
NSLAKKGQISVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLA
GNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFK
TSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYK
ILVKNKKKSHKSSEGSGKKKLSEQVSNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCK
KSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEISKKRNRSFEMSSFVETKGLEQLTK
SPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYE
YNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDM
FGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPSLACLRIAVYEEGGKFIGHRI
LPVQAIRPGYHYICLRNERNQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLME
QRAKQLAALTLEDEEEVKKEADPGETPSEAPSEAGTNPAENGVNHTTSLAPKPPSQALHS
QPAPGSVKAPAKTEDLIQSVLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKT
TDLIKEHTTKYNEIQNDYLRRRAALEKTAKKDSKKKSDPSSPDHGSSTIEQDLAALDAEM
TQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEIC
EKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQ
EKLVEKHKEIRQQILDEKPKGDGSSSFLSETCHEDPSVSPNITPPNPQALKW
Download sequence
Identical sequences J9P126
ENSCAFP00000039250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]