SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039254 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039254
Domain Number 1 Region: 79-160
Classification Level Classification E-value
Superfamily F-box domain 7.33e-20
Family F-box domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039254   Gene: ENSCAFG00000018861   Transcript: ENSCAFT00000029938
Sequence length 281
Comment pep:novel chromosome:CanFam3.1:X:104169042:104169884:1 gene:ENSCAFG00000018861 transcript:ENSCAFT00000029938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAFAPPKCIDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTG
LLERCSLSQQKFCCQKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVSWHWK
NLTELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHVTKPKTPPKDGFSIAN
VQPVTSRSPGEKQSPASAFRSSSSLRKKTHAAEKELPPWRSSDKHPTDIIRFNYLDNCDP
IEQIWQGRRKRHEMNPDFSRQSRDKKNKLQDRSRLRKAQSL
Download sequence
Identical sequences J9P130
PGODOG00000196803 ENSCAFP00000039254 ENSCAFP00000039254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]