SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039290 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039290
Domain Number 1 Region: 110-222
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-33
Family Phosphotyrosine-binding domain (PTB) 0.00000707
Further Details:      
 
Domain Number 2 Region: 2-88
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000211
Family Phosphotyrosine-binding domain (PTB) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039290   Gene: ENSCAFG00000011874   Transcript: ENSCAFT00000049974
Sequence length 284
Comment pep:known_by_projection chromosome:CanFam3.1:24:40200229:40282695:1 gene:ENSCAFG00000011874 transcript:ENSCAFT00000049974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYQRCWLVFKKASSKGPKRLEKFSDERAAYFRCYHKVTELNNVKNVARLPKSTKKHAIGI
YFNDDTSKTFACESDLEADEWCKVLQMECVGTRINDISLGEPDLLATGVEREQSERFNVY
LMPSPNLDVHGECALQITYEHICLWDVQNPRVKLISWPLSALRRYGRDAAWFTFEAGRMC
ETGEGLFIFQTRDGEAIYQKVHSAALAIAEQHERLLQSVKNSMLQMKMSERAASLSTMVP
LPRSAYWQHITRQRSAGQLCRLQDVSSPLKLHRTETFPAYRSEH
Download sequence
Identical sequences J9P166
ENSCAFP00000039290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]