SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039362 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039362
Domain Number 1 Region: 315-494
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.14e-33
Family Phospholipase D 0.051
Further Details:      
 
Domain Number 2 Region: 725-863,894-937
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.71e-17
Family Polyphosphate kinase C-terminal domain 0.051
Further Details:      
 
Domain Number 3 Region: 78-212
Classification Level Classification E-value
Superfamily PX domain 0.00000000000000654
Family PX domain 0.0071
Further Details:      
 
Domain Number 4 Region: 223-328
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000263
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 5 Region: 668-724
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00000138
Family Phospholipase D 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039362   Gene: ENSCAFG00000015246   Transcript: ENSCAFT00000050001
Sequence length 1071
Comment pep:known_by_projection chromosome:CanFam3.1:34:35917730:36044875:-1 gene:ENSCAFG00000015246 transcript:ENSCAFT00000050001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKNEPRVNTSALQKIAADMSNLIENLDTRELHFEGEEVDYDVSPSDPKTQEACIPFSA
IYKTQGFKEPNIQTYLSGCPVQAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVKEEPREMPSLPRSSENMIREEQFFGRR
KQLEDYLTKLLKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFKIKVGKKETETKYGLRID
NLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAVQENTLAKWYVNAKG
YFEDVANAMEEAEEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFVMLY
KEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSSVYLWAHHEKIVVIDQSVAFVGGI
DLAYGRWDDNEHRLTDVGSVKRVTGGLSSLGSFTAETTESMESLSLKNEKESSKNVPTSK
SVDDMDSKLKGIGKSRKFSKFSLYRQLHRHHLHNVDSISSIGSASSYCNHCRSRQNLIHG
LKPHLKLFRSSSKSEQGLPRPDTDTSSLRSLQTGMGELHGETRFWHGKDYCNFVFKDWVQ
LDKPFADFIDRYSTPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFL
LPKSQTTAHELKYQVPGSVHANVQLLRSAADWSAGIKYHEESIHTAYINVIENSKHYIYI
ENQFFISCADDKVVFNKIGDAIAQRILKAHREGQRYRVYVVIPLLPGFEGDISTGGGNAL
QAIMHFNYRTMCRGENSILGQLKAKRKNEIIFKISFCDFRTLEEVQGTQMIWVKSKLFLW
SLSPVPGSANINDRSMLGRRDSEMNVLVQDTETVPSVMDGQAYPAGRFARGLRLQCFRVV
LGYLSDPSENIQDPVSDKFFKEVWVATAARNATIYDKVFRCLPNDEVHNLIQLRDFITKP
ILAREDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAMVPTEVWT
Download sequence
Identical sequences J9P1D8
ENSCAFP00000039362 ENSCAFP00000022501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]