SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039439 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039439
Domain Number 1 Region: 722-895
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.06e-34
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.034
Further Details:      
 
Domain Number 2 Region: 601-685
Classification Level Classification E-value
Superfamily WWE domain 0.0000000903
Family WWE domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039439   Gene: ENSCAFG00000004102   Transcript: ENSCAFT00000045776
Sequence length 898
Comment pep:known_by_projection chromosome:CanFam3.1:16:9598405:9658535:1 gene:ENSCAFG00000004102 transcript:ENSCAFT00000045776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPEVCCFITKILCAHGGRMALDALLQEIALSEAQLREVLEAAGPDRFVLLETGDRAGV
TRAVVAATRARVCRRKFCQRPCEDLHLCKLNLLGRCHYSQAERNLCKYSHEVLSEENFKV
LKNHELSGLNKEELAVLLIQSDPFFLPEICKNYKGEGRRVICDKYPQCERLHICEHFTRG
NCGYANCLRSHNLMDRRVLAIMREHGLSPSVVQNIQDIFNNKHSRKKHSGYRAPPSYRRD
KAYRGRSKSRDRSFQGSTEFLPSAPAPAQKSCSSSPDPVGHRPPLDNVPVEDLAHKFGRL
GSQDCPQPSPVSPKANSLRGAGQVGGSRRFSENGSPEDLFYGHQDSIFFPSDSTPASNRK
GPDSGLNDKGTSRESVFSWSKATSGSVGSLQTPETITTRKSTGLLSPDGMSAEARGSNQN
AQYFPLFNNNVDGMATDGTSARSLNYKTTTRGQREKSLPRNQDAGTPPGNVQTTGTIMGG
DDPAAAPANDSAFDVGSTSSSRMDDCDPQEICLDHLCKGCQTENCNKVHFHLPYRWQMFF
ANTWMDLQPMENIEKAYCDPQIRIFSIGNKSIDFQKMTCNSIPIRRISTPSSVTTLTNFV
FATKWIWYWKKESDIWVQYGEEAGNQEASNIDSSYLESFFLLYPRGIVPFQAGSRNYELS
FIGMIQTNVASKTQKDVVRRPTFMSYKDVEQIKSNYQLMQTLSEPLISTLPPQPDFSLNG
YELVEINNQNPEYVMISESFKASMKNFKIENIKKIKNTKLLNAFERKKLKMNNRTEKILF
CATRRTYVESICKDNFNWIIHGSSDTKYGKGIYFTKDAIYSHKDQQDDTKNMVMFVARVL
VGDFTQGYRESLNPPPPPYDSYVDVRLNPSIFVIYEKDQIYPQYVIEYTEPEKACVIS
Download sequence
Identical sequences J9P1L5
ENSCAFP00000039439 XP_005629620.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]