SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039674 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039674
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000861
Family VPS36 N-terminal domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039674   Gene: ENSCAFG00000000991   Transcript: ENSCAFT00000044640
Sequence length 242
Comment pep:known_by_projection chromosome:CanFam3.1:10:23344094:23354621:-1 gene:ENSCAFG00000000991 transcript:ENSCAFT00000044640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSFMMPFELMSNCTIEQPVFAANFIKGIIQAAPDGGWEGQATFKLSFRKGGAIEFAQLM
MKAASAAARGVPLGSVNYWFSTPGLYVITGQGGVMCTPQMPCPAYPFVVYGPPQAGYGPP
EVGYGPSQAGYGPSQAGYRPPLVGYGPPQVGYGPPQGGYGQPPGVYGIPPAGYGALPAGN
EASASRNEVLPAANEAPPPRYEVPLARNRVGSGKYVVPQPSQYDTSLPPASSSEARPPSS
LI
Download sequence
Identical sequences J9P298
ENSCAFP00000039674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]