SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039789 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039789
Domain Number 1 Region: 49-261
Classification Level Classification E-value
Superfamily PH domain-like 3.67e-30
Family Pleckstrin-homology domain (PH domain) 0.00000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039789   Gene: ENSCAFG00000030366   Transcript: ENSCAFT00000049380
Sequence length 264
Comment pep:known chromosome:CanFam3.1:10:16844002:16849073:1 gene:ENSCAFG00000030366 transcript:ENSCAFT00000049380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGPSLPSPTSVLWSDPLDLCHFASLFFCNFLSTFQSGYFLLSDLSLPTVPQELQRLEAE
LGRPPERWKDTWDRVKAAQRLEGRPDGRGTPSSLLVSSVPHHRRSLGVYLQEGPVGSTLS
LSLDSDQSSGSTASSSRQAARRSTSTLYSQFQTAESENRSYEGTLYKKGAFMKPWKARWF
VLDKTKHQLRYYDHRVDTECKGVIDLAEVEAVAPGTPTMGAPKTVDEKAFFDVKTTRRVY
NFCAQDVPSAQQWVDQIQSCLSDA
Download sequence
Identical sequences J9P2L2
ENSCAFP00000039789 ENSCAFP00000039789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]