SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039957 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039957
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily PH domain-like 3.13e-25
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000189
Further Details:      
 
Domain Number 2 Region: 307-345
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0000000000602
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039957   Gene: ENSCAFG00000024629   Transcript: ENSCAFT00000037982
Sequence length 347
Comment pep:novel chromosome:CanFam3.1:18:53665846:53666927:1 gene:ENSCAFG00000024629 transcript:ENSCAFT00000037982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WLLTGTGPPGFQCIQIYHNTTANSFQVVGRKVQPDQQVVINCAIVWGIKYNQATPTFHRW
CNTRQVWGLNFGSKEDDAQSAAAITSALETLEGGEPPPPPPPVGGPERSSSEEMEQQKRQ
QPPPEHMERQVSNAGGSPAHPAGGSRPPPGPPPPPGMSLSGGSVAGHRAGAGPPPASPLP
TAQGPRGGGGAPGLAAAIAEAKLRKVSKQEEASGGPSAPKAESTRSTGGGPMEEMNAMLA
GRRKATQVGKKPPSEEPEARGQRPEARVPVPAQSKSVRRPWEKNSTTLPRMKSSSSTTSE
AHPSTPSSSDEERVKQELLEEVRKELKTGKKEIIEAFVQELRKPGSP
Download sequence
Identical sequences J9P328
ENSCAFP00000039957 ENSCAFP00000039957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]