SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000040080 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000040080
Domain Number 1 Region: 8-76
Classification Level Classification E-value
Superfamily Cyclin-like 0.0000000000000119
Family Cyclin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000040080   Gene: ENSCAFG00000008454   Transcript: ENSCAFT00000048179
Sequence length 207
Comment pep:known_by_projection chromosome:CanFam3.1:28:9491528:9511585:1 gene:ENSCAFG00000008454 transcript:ENSCAFT00000048179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCDLCILLLRFIFDVSTDYAFLNYAPSLVAAACVASSRIILRLSPTWPTRLHRLTAYSWD
FLVQCIERLLIAHDNDVKEANKQRGQAGSQPAQLSVLQSASQPSRPVHFQQPHYLHQTHH
TSLQYRHPVAEQPSCQQIGSTTHTSSYTLQTCPAGFQTSVQGLGHVQTGVGMSLAIPVEV
KPCLNVSYNRSYQINEHYPCITPCFER
Download sequence
Identical sequences J9P3F1
ENSCAFP00000040080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]