SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000040218 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000040218
Domain Number 1 Region: 53-198
Classification Level Classification E-value
Superfamily PH domain-like 6e-57
Family Ran-binding domain 0.000000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000040218   Gene: ENSCAFG00000014178   Transcript: ENSCAFT00000044411
Sequence length 239
Comment pep:known_by_projection chromosome:CanFam3.1:26:29210837:29217933:-1 gene:ENSCAFG00000014178 transcript:ENSCAFT00000044411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPFTRRDCPLRAQLSSGWGPGSGASRVTSLHLPPQDTHEDHDTSTENADESNHDPQFEP
IVSLPEQEIKTLEEDEEELFKMRAKLFRFASENDLPEWKERGTGDVKLLKHKEKGTIRLL
MRRDKTLKICANHYITPMMELKPNAGSDRAWVWNTHADFADECPKPELLAIRFLNAENAQ
KFKTKFEECRKEIEEREKKGSGKNDDAEKVTEKLEALSVKEESKESEDTESKAGAEEEQ
Download sequence
Identical sequences J9P3T9
ENSCAFP00000040218 ENSCAFP00000020890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]