SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000040275 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000040275
Domain Number 1 Region: 292-410
Classification Level Classification E-value
Superfamily PH domain-like 3.7e-33
Family Pleckstrin-homology domain (PH domain) 0.0000114
Further Details:      
 
Domain Number 2 Region: 454-551
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.43e-22
Family Protein kinases, catalytic subunit 0.0019
Further Details:      
 
Domain Number 3 Region: 132-190
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.26e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 
Domain Number 4 Region: 8-66
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.84e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000040275   Gene: ENSCAFG00000012553   Transcript: ENSCAFT00000043635
Sequence length 554
Comment pep:known_by_projection chromosome:CanFam3.1:8:9029080:9090821:-1 gene:ENSCAFG00000012553 transcript:ENSCAFT00000043635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFTASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFK
IPNNCSGVRRRRLSNVSLTGLSTVRTASAELSSSAPDEPLLQKSPSESFIGREKRSNSQS
YIGRPIQLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQCKDCRFNCHKR
CASKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDMEEAMVQDAEVV
MAECQNDSGEMQDPDPDPEDSNRTISPSTSNNIPLMRVVQSVKHTKRKSSTVLKEGWMVH
YTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILSLEPAKPSALIPNGANPHC
FEITTANVVYYVGENVVNPSSPPPNSSVLTSGVGADVARMWEMAIQHALMPVIPKGSTVG
SGTNSHRDISVSISVSNCQVQENVDISTVYQIFPDEVLGSGQFGIVYGGKHRKTGRDVAI
KIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVMEKLHGDMLEMIL
SSEKDRYPWKLLTS
Download sequence
Identical sequences J9P3Z6
ENSCAFP00000040275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]